GET /api/protein/UniProt/A0A2L2Y022/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2L2Y022",
        "id": "A0A2L2Y022_PARTP",
        "source_organism": {
            "taxId": "114398",
            "scientificName": "Parasteatoda tepidariorum",
            "fullName": "Parasteatoda tepidariorum (Common house spider)"
        },
        "name": "26S proteasome non-ATPase regulatory subunit 14",
        "description": [
            "Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear"
        ],
        "length": 296,
        "sequence": "QAPPPTDGAVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINPNMVVLGQEPRQTTSNLGHLSKPSIQALIHGLNRHYYSISINYRKNELEQKMLLNLHKKSWMDGLMLQDYNEHSNTNEKTVSEMLELAKAYNKSLEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDSLMNSNIVQCLGAMLDTVVFQ",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008233",
                "name": "peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008237",
                "name": "metallopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3b44ef0f47bc482a0bcfb398f0a268f978f4ce6c",
        "counters": {
            "domain_architectures": 5250,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 2,
                "smart": 1,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5250
        }
    }
}