GET /api/protein/UniProt/A0A2L0UB95/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2L0UB95",
"id": "A0A2L0UB95_9MICC",
"source_organism": {
"taxId": "37921",
"scientificName": "Arthrobacter agilis",
"fullName": "Arthrobacter agilis"
},
"name": "Orotate phosphoribosyltransferase",
"description": [
"Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP)"
],
"length": 191,
"sequence": "MTAETSAQTTDRTRLLELIRELAVVHERVTLSSGVEADYYIDLRRITLHHEASALVGRVMLQLLDDAGIAFEAAGGLTMGADPVGTAVMHAAGQAGRPIDAFVVRKTQKTHGMGRQVEGPDVSGRPVVVLEDTSTTGGSALTAVEGVRRAGGDVRAVAVIVDRSTGSKERIESEAGVPYLFAFGRDELGLA",
"proteome": null,
"gene": "pyrE",
"go_terms": [
{
"identifier": "GO:0004588",
"name": "orotate phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006221",
"name": "pyrimidine nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1
}
}
}