General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K9QHL2",
        "id": "A0A2K9QHL2_9GAMM",
        "source_organism": {
            "taxId": "204042",
            "scientificName": "Dickeya zeae",
            "fullName": "Dickeya zeae"
        },
        "name": "RNA polymerase-binding transcription factor DksA",
        "description": [
            "Transcription factor that acts by binding directly to the RNA polymerase (RNAP). Required for negative regulation of rRNA expression and positive regulation of several amino acid biosynthesis promoters. Also required for regulation of fis expression"
        ],
        "length": 151,
        "sequence": "MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNDAQLAHFRRILEAWRNQLRDEVDRTVSHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIAKTLQKIEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG",
        "proteome": "UP000824976",
        "gene": "dksA",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d82a727f4c8057974f0fbd75da7dd8cbf42afb9b",
        "counters": {
            "domain_architectures": 10481,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10481
        }
    }
}