GET /api/protein/UniProt/A0A2K8SEI5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K8SEI5",
        "id": "A0A2K8SEI5_9MOLU",
        "source_organism": {
            "taxId": "1336749",
            "scientificName": "Spiroplasma floricola 23-6",
            "fullName": "Spiroplasma floricola 23-6"
        },
        "name": "Pyrimidine nucleoside phosphorylase C-terminal domain-containing protein",
        "description": [
            "The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis"
        ],
        "length": 433,
        "sequence": "MNFVDIIEKKKKNIELSTQEIYWVVNSFVNNSLKDYQMSAFNMAVWFNGMSTKEIASFTQAMIDSGITYDLSEVKGLIADKHSTGGIGDKTSLIFSPLVAKFGVKVAKLSGRGLGQTGGTIDKLESCPGWTGEISDHRFKEILNEIGISIMSQSSQVVPADKKLYALRDVTGTVDSIPLIASSIMSKKLVIPANSIILDVKMGSGAFMKDLDKAVELSKTMIGIGKEHNRNVSVMITNMDKPLGRAIGNAIEVKEAWDTLNGNGPSDLEELCVTAAGLTLVQNEVFKDLKTAKEELLKVLKDKSAAHLLKDFIEAQNGNFDVIIDYDKNFSTKHVIEVFAQKEGYVSFVSADQLGYLSMYLGAGRATKEEEIDFSAGIYLNKTTNEFVKKGEVIMTLYTNRDNVESFKQKAEELILIKDKKENEELILKLLTS",
        "proteome": "UP000231823",
        "gene": "deoA",
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016763",
                "name": "pentosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006213",
                "name": "pyrimidine nucleoside metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004645",
                "name": "1,4-alpha-oligoglucan phosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006206",
                "name": "pyrimidine nucleobase metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016154",
                "name": "pyrimidine-nucleoside phosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6227dab17dd3d397b97ba2023a04c04a1d191916",
        "counters": {
            "domain_architectures": 15827,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15827
        }
    }
}