General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6V5Z0",
        "id": "A0A2K6V5Z0_SAIBB",
        "source_organism": {
            "taxId": "39432",
            "scientificName": "Saimiri boliviensis boliviensis",
            "fullName": "Saimiri boliviensis boliviensis (Bolivian squirrel monkey)"
        },
        "name": "Selenoprotein W",
        "description": [
            "Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency"
        ],
        "length": 86,
        "sequence": "MALTVRVVYCGAGYKSKYLQLKKKLEDEFPGRLDISGEGTPQATGFFEVTVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG",
        "proteome": "UP000233220",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "58d4beb6754800c8fb86046e2a7f6dd45ad72275",
        "counters": {
            "domain_architectures": 11335,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11335
        }
    }
}