GET /api/protein/UniProt/A0A2K6UEQ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6UEQ8",
        "id": "A0A2K6UEQ8_SAIBB",
        "source_organism": {
            "taxId": "39432",
            "scientificName": "Saimiri boliviensis boliviensis",
            "fullName": "Saimiri boliviensis boliviensis (Bolivian squirrel monkey)"
        },
        "name": "Tumor necrosis factor receptor superfamily member 17",
        "description": [
            "Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK"
        ],
        "length": 183,
        "sequence": "MLQMARQCSQNEYFDSLLHACKPCQLRCSNTPPLTCQRYCNASGTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKMSSEPLKDKFKNTGSGLLGMANVDLEKTGTGDEIILPRGLQYTVEECTCEDCVKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLPAALSVMEIEKSISAR",
        "proteome": "UP000233220",
        "gene": "TNFRSF17",
        "go_terms": [
            {
                "identifier": "GO:0038023",
                "name": "signaling receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033209",
                "name": "tumor necrosis factor-mediated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0a887b0719432712d09cd087b2bc066ea343a7c2",
        "counters": {
            "domain_architectures": 537,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 537
        }
    }
}