GET /api/protein/UniProt/A0A2K6QI69/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6QI69",
        "id": "A0A2K6QI69_RHIRO",
        "source_organism": {
            "taxId": "61622",
            "scientificName": "Rhinopithecus roxellana",
            "fullName": "Rhinopithecus roxellana (Golden snub-nosed monkey)"
        },
        "name": "Parvalbumin",
        "description": [
            "In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions"
        ],
        "length": 133,
        "sequence": "MDEDLSQMKKMALTMGTSLSDKDIELLPTDMRHYGSFNYLKFFEHVRKFHASGQLDEAIRKAFQALDKDRSGFIEWNEIKYILSIIPSSRPTAPLTDEEAEAIIQAADTDGDGRINYEEFSELIKKEKIPKKK",
        "proteome": "UP000233200",
        "gene": "PVALEF",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ecca215d1474ead666e5466ef178e613f3ad8a6f",
        "counters": {
            "domain_architectures": 65598,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65598
        }
    }
}