General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6PR63",
        "id": "A0A2K6PR63_RHIRO",
        "source_organism": {
            "taxId": "61622",
            "scientificName": "Rhinopithecus roxellana",
            "fullName": "Rhinopithecus roxellana (Golden snub-nosed monkey)"
        },
        "name": "Carboxypeptidase B2",
        "description": [
            "Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin"
        ],
        "length": 423,
        "sequence": "MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIAKKKQVHFFVNSSDVDNVKAHLNVSGILCSVLLADVEDLIQQQISNDTVSPRASTSYYEQYHSLNEIYSWIELITEKYPDMLTKIHIGSSYEKHPLYVLKVSGKEQTAKNAMWIDCGIHAREWISPAFCLWFIGHITEYYGIIGEYTNLLRHVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNRCIGTDLNRNFASKHWCEEGASSFSCSETYCGLYPESEPEVKAVANFLRRNINHMKAYISMHSYSQHIVFPYSYTRSKSKDHEELSRVASEAVRAIQKTSKNIRYTHGHGSETLYLAPGGADDWIYDLGIKYSFTIELRDTGKYGFLLPERYIKPTCKDAFAAVSKIAWHVIRNV",
        "proteome": "UP000233200",
        "gene": "CPB2",
        "go_terms": [
            {
                "identifier": "GO:0004181",
                "name": "metallocarboxypeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042730",
                "name": "fibrinolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ef46df62aececb84494ced1d8e69718377e5d3a0",
        "counters": {
            "domain_architectures": 10361,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10361
        }
    }
}