HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K6PGV1",
"id": "A0A2K6PGV1_RHIRO",
"source_organism": {
"taxId": "61622",
"scientificName": "Rhinopithecus roxellana",
"fullName": "Rhinopithecus roxellana (Golden snub-nosed monkey)"
},
"name": "Annexin",
"description": [
"This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade"
],
"length": 318,
"sequence": "MVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKEVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLLNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGED",
"proteome": "UP000233200",
"gene": null,
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005544",
"name": "calcium-dependent phospholipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050819",
"name": "negative regulation of coagulation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1070ab59ec8b9580225489ba6f8a5ef3d4745615",
"counters": {
"domain_architectures": 18573,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 18573
}
}
}