HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K6P708",
"id": "A0A2K6P708_RHIRO",
"source_organism": {
"taxId": "61622",
"scientificName": "Rhinopithecus roxellana",
"fullName": "Rhinopithecus roxellana (Golden snub-nosed monkey)"
},
"name": "Rab GDP dissociation inhibitor",
"description": [
"GDP-dissociation inhibitor preventing the GDP to GTP exchange of most Rab proteins. By keeping these small GTPases in their inactive GDP-bound form regulates intracellular membrane trafficking. Negatively regulates protein transport to the cilium and ciliogenesis through the inhibition of RAB8A",
"Regulates the GDP/GTP exchange reaction of most RAB proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP"
],
"length": 445,
"sequence": "MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGMESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED",
"proteome": "UP000233200",
"gene": "GDI2",
"go_terms": [
{
"identifier": "GO:0005092",
"name": "GDP-dissociation inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007264",
"name": "small GTPase-mediated signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005093",
"name": "Rab GDP-dissociation inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015031",
"name": "protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bf4a0619627864712015915d155a6b211ace67a2",
"counters": {
"domain_architectures": 9748,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 3,
"pfam": 1,
"panther": 1,
"prints": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9748
}
}
}