General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6K3L0",
        "id": "A0A2K6K3L0_RHIBE",
        "source_organism": {
            "taxId": "61621",
            "scientificName": "Rhinopithecus bieti",
            "fullName": "Rhinopithecus bieti (Black snub-nosed monkey)"
        },
        "name": "Stress-associated endoplasmic reticulum protein",
        "description": [
            "Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins",
            "Interacts with target proteins during translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation and facilitate correct glycosylation"
        ],
        "length": 66,
        "sequence": "MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM",
        "proteome": "UP000233180",
        "gene": "SERP1",
        "go_terms": [
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "11473d2f9b226fdb2f8a73509109831429b8d765",
        "counters": {
            "domain_architectures": 3909,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3909
        }
    }
}