GET /api/protein/UniProt/A0A2K6FCZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6FCZ5",
        "id": "A0A2K6FCZ5_PROCO",
        "source_organism": {
            "taxId": "379532",
            "scientificName": "Propithecus coquereli",
            "fullName": "Propithecus coquereli (Coquerel's sifaka)"
        },
        "name": "GTP:AMP phosphotransferase AK3, mitochondrial",
        "description": [
            "Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities"
        ],
        "length": 216,
        "sequence": "ARLLRAVIMRALGSGKGTVSSRITQHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLAQYSWLFDGFPRTLPQAEALDKAYQIDTVINLNVPFEVIKQRLTARWIPPASGRVYNMEFDPPQTVGIDDVTGEPLIQREDDRPQTVIKRLKAYEAQTKPTGVLETFSGTETNKIWPQVYSFLQTKVPQTNQKASVTP",
        "proteome": "UP000233160",
        "gene": "AK3",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019205",
                "name": "nucleobase-containing compound kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006139",
                "name": "nucleobase-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004017",
                "name": "AMP kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016776",
                "name": "phosphotransferase activity, phosphate group as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cd3ce6da6122bbe1e4b04d5ae2a462ecdf76a3f9",
        "counters": {
            "domain_architectures": 27793,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 2,
                "pfam": 2,
                "hamap": 2,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27793
        }
    }
}