General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6EG46",
        "id": "A0A2K6EG46_PROCO",
        "source_organism": {
            "taxId": "379532",
            "scientificName": "Propithecus coquereli",
            "fullName": "Propithecus coquereli (Coquerel's sifaka)"
        },
        "name": "BPI fold-containing family B member 3",
        "description": [
            "May have the capacity to recognize and bind specific classes of odorants. May act as a carrier molecule, transporting odorants across the mucus layer to access receptor sites. May serve as a primary defense mechanism by recognizing and removing potentially harmful odorants or pathogenic microorganisms from the mucosa or clearing excess odorant from mucus to enable new odorant stimuli to be received"
        ],
        "length": 474,
        "sequence": "VQPKMLGVWSLLLLWGLVAPCQGLLETVGTLARIDKDELGKAIQNSLVGGPILQNVLGTVTSVNQGLLGFGGLLGGGGLLGHGGVFGVVKELSGLKIEELTLPKVSLKLLPGFGVQLSLHTKVGLHGSGPLGGLLQLAAEVNVSSRVALGMSPRGTPTLILKRCSTLLGHISLLSGLLPAPLFGVVEETLFKVLQGLLCPVVDSVLGVVNELLGAVLSLVPLGALGSVEFSLATLPLISNQYIELDINPIVKSVGGDIIDFPKHPVPVKVPPKEDHTTQVTVPLYLFNTMFGLLQANGALNIDITPELVPVPLTTTDLAALVPEALGKLPPGQHLQLSLRAKEAPTVTLQNKKASVSIPADIHVLPYVPQGTPEALFKLNGVVTLSAQLAPSATKLHISLSLERLSVKLASSYSRAFDASRLEEWLGDAVRAVYVPKLNVALDIGIPLPKILNVNFANSGLEIIENAVVLTVAS",
        "proteome": "UP000233160",
        "gene": "BPIFB3",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "039037fd0dd39e90081151ccec5366a75852e8a8",
        "counters": {
            "domain_architectures": 6576,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6576
        }
    }
}