General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6B878",
        "id": "A0A2K6B878_MACNE",
        "source_organism": {
            "taxId": "9545",
            "scientificName": "Macaca nemestrina",
            "fullName": "Macaca nemestrina (Pig-tailed macaque)"
        },
        "name": "MORN repeat-containing protein 3",
        "description": [
            "Assembles a suppression complex (suppresome) by tethering SIRT1 and MDM2 to regulate composite modifications of p53/TP53. Confers both deacetylation-mediated functional inactivation, by SIRT1, and ubiquitination-dependent degradation, by MDM2, of p53/TP53, promoting a proliferative and cell survival behaviors. May play a role in the regulation of spermatogenesis"
        ],
        "length": 240,
        "sequence": "MPVSKCPKKSESLWKGWDRKAQKNGLRRQVYAVNGDYYVGEWKDNVKHGKGTQVWKKNGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGDGMLRLKNGNRYEGCWERGMKNGPGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAQALAMFKKTEEGD",
        "proteome": "UP000233120",
        "gene": "MORN3",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2cdca9d3114e31bbd3fc75c9bd8dd379ca6d3623",
        "counters": {
            "domain_architectures": 2945,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2945
        }
    }
}