GET /api/protein/UniProt/A0A2K5S0S1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K5S0S1",
"id": "A0A2K5S0S1_CEBIM",
"source_organism": {
"taxId": "2715852",
"scientificName": "Cebus imitator",
"fullName": "Cebus imitator (Panamanian white-faced capuchin)"
},
"name": "Cold-inducible RNA-binding protein",
"description": [
"Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed"
],
"length": 207,
"sequence": "MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSPDSRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSGDYYSSRSQSSGYGDRSSGGSYRDSYDSYGKSHSEGATLLWPAVGARFTLAPSPSDLGWTLRPCHCTCP",
"proteome": "UP000233040",
"gene": "CIRBP",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0eb7dadcabd2c02a94f505008bf374cf6371f960",
"counters": {
"domain_architectures": 222038,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"smart": 2,
"pfam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 222038
}
}
}