General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5S0S1",
        "id": "A0A2K5S0S1_CEBIM",
        "source_organism": {
            "taxId": "2715852",
            "scientificName": "Cebus imitator",
            "fullName": "Cebus imitator (Panamanian white-faced capuchin)"
        },
        "name": "Cold-inducible RNA-binding protein",
        "description": [
            "Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed"
        ],
        "length": 207,
        "sequence": "MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSPDSRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSGDYYSSRSQSSGYGDRSSGGSYRDSYDSYGKSHSEGATLLWPAVGARFTLAPSPSDLGWTLRPCHCTCP",
        "proteome": "UP000233040",
        "gene": "CIRBP",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0eb7dadcabd2c02a94f505008bf374cf6371f960",
        "counters": {
            "domain_architectures": 222038,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 2,
                "pfam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 222038
        }
    }
}