HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K5RJU7",
"id": "A0A2K5RJU7_CEBIM",
"source_organism": {
"taxId": "2715852",
"scientificName": "Cebus imitator",
"fullName": "Cebus imitator (Panamanian white-faced capuchin)"
},
"name": "SAM pointed domain-containing Ets transcription factor",
"description": [
"May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter"
],
"length": 319,
"sequence": "MGSASPGLSSVSPSHLLLPPDSVSRTGLEKVAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLCPDDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPGGSLDLGPSGLALEEHSLEQVQSMVVGEVLKDIETACKLLNITADPVDWSPGNVQKWLLWTEHQYRLPPVGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSASTIEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI",
"proteome": "UP000233040",
"gene": "SPDEF",
"go_terms": [
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006357",
"name": "regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "522927238307a85066168b858327df5283cc4088",
"counters": {
"domain_architectures": 10817,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"profile": 2,
"smart": 2,
"pfam": 2,
"cdd": 1,
"panther": 1,
"prosite": 2,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10817
}
}
}