General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5Q2B9",
        "id": "A0A2K5Q2B9_CEBIM",
        "source_organism": {
            "taxId": "2715852",
            "scientificName": "Cebus imitator",
            "fullName": "Cebus imitator (Panamanian white-faced capuchin)"
        },
        "name": "Proto-oncogene vav",
        "description": [
            "Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation"
        ],
        "length": 847,
        "sequence": "MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRTCCLAEIKQTEEKYTETLESIEKYFMVPLKRFLTAAEFDSIFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLHLQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSTGHRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE",
        "proteome": "UP000233040",
        "gene": "VAV3",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005085",
                "name": "guanyl-nucleotide exchange factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a7fea9b74d33058e192485bfa7367c54c2a5a66",
        "counters": {
            "domain_architectures": 1087,
            "entries": 61,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 12,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 6,
                "cathgene3d": 6,
                "cdd": 7,
                "ssf": 5,
                "smart": 6,
                "pfam": 6,
                "panther": 1,
                "prints": 3,
                "prosite": 2,
                "interpro": 19
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1087
        }
    }
}