General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5I5V8",
        "id": "A0A2K5I5V8_COLAP",
        "source_organism": {
            "taxId": "336983",
            "scientificName": "Colobus angolensis palliatus",
            "fullName": "Colobus angolensis palliatus (Peters' Angolan colobus)"
        },
        "name": "tRNA-queuosine alpha-mannosyltransferase",
        "description": [
            "Glycosyltransferase that specifically catalyzes mannosylation of cytoplasmic tRNA(Asp) modified with queuosine at position 34 (queuosine(34)). Mannosylates the cyclopentene moiety of queuosine(34) in tRNA(Asp) to form mannosyl-queuosine(34). Mannosylation of queuosine(34) in tRNA(Asp) is required to slow-down elongation at cognate codons, GAC and GAU, thereby regulating protein translation"
        ],
        "length": 376,
        "sequence": "MSILIIEAFYGGSHKQLVDLLQEELGDCVLYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKTILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSIGKFMKLIPDHRPKNLESIIRPKCQVIYFPIRFPDVSRFMPKHKATHLKKMLSLKGNGGTVLSMALPFQPEQRDSEGLLKNSNSECDAHCGLDTARREYLGNSLREESDLKKSTSPENSSSHCGENKQNLTVNPCTTLGGVANQQRLLHIVWPHRWEHDKDPESFFKVLMHLKDLGLNFHVSILGETFTDVPGWKLCTVGVTHFVLKIWFIPKYFQLNICILHLNSFQKGSRISARDQIL",
        "proteome": "UP000233080",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1e5ffe1bde5406b136ac9e45bc414bc8bc64abd4",
        "counters": {
            "domain_architectures": 712,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 712
        }
    }
}