GET /api/protein/UniProt/A0A2K5EIN8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5EIN8",
        "id": "A0A2K5EIN8_AOTNA",
        "source_organism": {
            "taxId": "37293",
            "scientificName": "Aotus nancymaae",
            "fullName": "Aotus nancymaae (Ma's night monkey)"
        },
        "name": "DCN1-like protein",
        "description": [
            "Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs). May play a role in DNA damage response and may participate in cell proliferation and anchorage-independent cell growth"
        ],
        "length": 152,
        "sequence": "MPVKKKRKSPGVATAVAEDGGLKKCKISRCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS",
        "proteome": "UP000233020",
        "gene": "DCUN1D5",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aa9b7783716604b54160d7347c630aebb2e0f5d9",
        "counters": {
            "domain_architectures": 8047,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8047
        }
    }
}