GET /api/protein/UniProt/A0A2K4FBS8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K4FBS8",
"id": "A0A2K4FBS8_9STAP",
"source_organism": {
"taxId": "1607738",
"scientificName": "Staphylococcus argensis",
"fullName": "Staphylococcus argensis"
},
"name": "Protein translocase subunit SecY",
"description": [
"The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently"
],
"length": 430,
"sequence": "MFQTLVNFFKTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPNAFDQQQGSQGVTDLLNTFGGGALKNFSIFAMGIMPYITASIVMQLLQMDIVPKFSEWAKQGDVGRKKLTNVTRYFAVILAFVQSIGMAFQFNNYLKGALLIDQSIMSYLLIAVVLTTGTAFLMWLGEQITQFGVGNGISIIIFAGILSTLPSSINQFYQQAFVGAEDVSMAWLKVIGLIVGLILLTIGAIYVLQALRKVPIQYAKKQSAQRIGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFFPDADWAQKVSSVANPSNNIGMIVYIILIIAFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYITKVLYRLTFVGSIFLAVVAILPILATKLMGLPQSIQVGGTSLLIVIGVAIETMKSLEAQVSQKEYRGFGRR",
"proteome": "UP000242712",
"gene": "secY",
"go_terms": [
{
"identifier": "GO:0015031",
"name": "protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9938721f5ebf4880c46db3c12966b5aff0b4c61",
"counters": {
"domain_architectures": 31007,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pirsf": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"prints": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 31007
}
}
}