HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K3YGS0",
"id": "A0A2K3YGS0_9STAP",
"source_organism": {
"taxId": "522262",
"scientificName": "Staphylococcus rostri",
"fullName": "Staphylococcus rostri"
},
"name": "Phospho-N-acetylmuramoyl-pentapeptide-transferase",
"description": [
"Catalyzes the initial step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan: transfers peptidoglycan precursor phospho-MurNAc-pentapeptide from UDP-MurNAc-pentapeptide onto the lipid carrier undecaprenyl phosphate, yielding undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide, known as lipid I"
],
"length": 321,
"sequence": "MGIISAVIAFIITAVLVPILIPTLKRMKFGQSIREEGPQSHMKKTGTPTMGGLTFLIGAIVTTIIASIFVEPASPLLLLLFVTIGFGLIGFIDDYIIVVKKNNQGLTSKQKFLAQIVIAVIFFIVAKGFNAFDFSTDINLPFTDVSIPLSFAYVIFIVFWQVGFSNAVNLTDGLDGLATGLSIIGFTVYAIMSFVLEQPAIGVFCIIMVAALAGFLPYNINPAKVFMGDTGSLALGGIFATVSIMLNQELSLLFIGLVFVIETLSVMIQVTSFKLTGKRVFKMSPLHHHFELVGWSEWKVVTVFWSVGFITGLIGLWIGVS",
"proteome": "UP000242752",
"gene": "mraY",
"go_terms": [
{
"identifier": "GO:0008963",
"name": "phospho-N-acetylmuramoyl-pentapeptide-transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016780",
"name": "phosphotransferase activity, for other substituted phosphate groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c5f156dcacc2831f4f03c4654ba034cef8945ec7",
"counters": {
"domain_architectures": 33525,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"prosite": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 33525
}
}
}