GET /api/protein/UniProt/A0A2J8WF41/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2J8WF41",
"id": "A0A2J8WF41_PONAB",
"source_organism": {
"taxId": "9601",
"scientificName": "Pongo abelii",
"fullName": "Pongo abelii (Sumatran orangutan)"
},
"name": "Centriolar satellite-associated tubulin polyglutamylase complex regulator 1",
"description": [
"Regulator of the tubulin polyglutamylase complex (TPGC) that controls cytoskeletal organization, nuclear shape, and cilium disassembly by balancing microtubule and actin assembly. Regulates the assembly and stability of the TPGC and thereby modulates polyglutamylation of the microtubule, which antagonizes MAP4 binding"
],
"length": 274,
"sequence": "MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYENLLSGKNPNTVIVPTSSSGQHRQRPALGEAGMLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHHGINQALGALPDKGDLMHDPAMDEELERL",
"proteome": null,
"gene": "CR201_G0010922",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "16b1306c37f34729cff8037296afafd50cd92cc0",
"counters": {
"domain_architectures": 1067,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1067
}
}
}