HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I4S6V5",
"id": "A0A2I4S6V5_9CHLO",
"source_organism": {
"taxId": "2025116",
"scientificName": "Chlorella sp. ATCC 30562",
"fullName": "Chlorella sp. ATCC 30562"
},
"name": "Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein",
"description": [
"Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP"
],
"length": 300,
"sequence": "MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIITDNGFDALFAANRIVASVREKSKTHPLRLAGLIGNRTAKRDLIDKYVEVCPMPVLEVLPLIEDIRVSRVKGKTVFEMAETEQPLTYICDFYLNIADQLLASPEGVIPTELEDRELFTLLSTFYLTGNPQTQVETEQTNTTQLTAKSASELDFLIV",
"proteome": null,
"gene": "chlL",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016730",
"name": "oxidoreductase activity, acting on iron-sulfur proteins as donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015995",
"name": "chlorophyll biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019685",
"name": "photosynthesis, dark reaction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "071df9b5c0283bbb9290ef29639d54eb5a20356f",
"counters": {
"domain_architectures": 24594,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"profile": 1,
"ssf": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 2,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24594
}
}
}