HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I4BL30",
"id": "A0A2I4BL30_AUSLI",
"source_organism": {
"taxId": "52670",
"scientificName": "Austrofundulus limnaeus",
"fullName": "Austrofundulus limnaeus (Annual killifish)"
},
"name": "Coatomer subunit alpha",
"description": [
"The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors",
"Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor"
],
"length": 1222,
"sequence": "MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVETDVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLGAHPNLNLFAAGHDSGMIVFKLERERPAYAVHGNMLYYVKDRFLRQLDFNSSKDTAVMQLRSGSKFPVFSMSYNPAENAVLLCTRATNLENSTYDLYSIPKESDSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIVKKVQVPSCEEIFYAGTGSLLLRDADGVTLFDVQQKRSLATVKIAKVKYVVWSSDTSHVALLAKHAIMICNRKLESLCNIHENIRVKSGAWDESGVFIYTTSNHIKYALTSGDHGIIRTLDLPIYATRVRGNSVYCLDRECRPRVLTIDPTEYRFKLALVNRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEVALEAAKALDERSCWERLGEAALLQGHHQVVEMCYQRTKNFDKLTFLYLITGNLAKLRKMMKIAEIRKDMSGHYQAALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAEALKETFDPEKETVPEVDPNAQLLQPPPPINPLDTNWPLLTVSKGFFEGAIPAKGKAGQMAADLDMEAAGGEGWGDDAELTMDEDGFIDAQDGLGEEGMVKEEGGGWDIDEDVDLPPELDVAIGXGGGAEDGFFVPPTKGMSPTQMWCNNSQLPVDHILAGSYETAMRLLHDQVGVVNFDPYKTLFMQTFSRGRTCYLGLPSLPCLRGHPHRNWKDCGAKQGLPAVGLRLSDLISRLQQCYQLTTSGRFEEAVERFRVILLSVPLLVVDNKQEIAEAQQLLTICKEYIVGLTMEIERKKLPKETLEQQKRICEMAAYFTHCNLQPVHMVLVLRTALNLFFKLRNFKTAAGFARRLLELGPKPDVAQQTRKILAACEKTLTDTHQLNYDPHNPFDLCAASFVPLYRGRPVEKCPLSGACYCPPYKGQICRVTQVTEIGKDVIGLRVSPLQFR",
"proteome": "UP000192220",
"gene": "copa",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030117",
"name": "membrane coat",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030126",
"name": "COPI vesicle coat",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "f9d81b453ef89dd8f38d6fb4056c7eb0a0708e00",
"counters": {
"domain_architectures": 1961,
"entries": 28,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 1,
"pfam": 4,
"ssf": 2,
"cdd": 2,
"profile": 2,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 11
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1961
}
}
}