GET /api/protein/UniProt/A0A2I3TNK5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I3TNK5",
"id": "A0A2I3TNK5_PANTR",
"source_organism": {
"taxId": "9598",
"scientificName": "Pan troglodytes",
"fullName": "Pan troglodytes (Chimpanzee)"
},
"name": "Elongator complex protein 4",
"description": [
"Component of the elongator complex which is required for multiple tRNA modifications, including mcm5U (5-methoxycarbonylmethyl uridine), mcm5s2U (5-methoxycarbonylmethyl-2-thiouridine), and ncm5U (5-carbamoylmethyl uridine). The elongator complex catalyzes the formation of carboxymethyluridine in the wobble base at position 34 in tRNAs"
],
"length": 131,
"sequence": "MAAAATCGSVAASTGSAVATASKNNVTSFQRRGRRASGTNDSGPRLVSITGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQCYTC",
"proteome": "UP000002277",
"gene": "ELP4",
"go_terms": [
{
"identifier": "GO:0002098",
"name": "tRNA wobble uridine modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033588",
"name": "elongator holoenzyme complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6db919ca20c15fd2ad5a66fa213700e9dc5f159c",
"counters": {
"domain_architectures": 4469,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4469
}
}
}