GET /api/protein/UniProt/A0A2I3NE63/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I3NE63",
        "id": "A0A2I3NE63_PAPAN",
        "source_organism": {
            "taxId": "9555",
            "scientificName": "Papio anubis",
            "fullName": "Papio anubis (Olive baboon)"
        },
        "name": "Cilia- and flagella-associated protein 300",
        "description": [
            "Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly"
        ],
        "length": 267,
        "sequence": "MATGELGDVGGYYFRFLPQKTFQSLNSKEITSRLRQWSMLGRIKAQAFGFDQTFQAYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWITLGTEVKKIEATNVPCTQVSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETAKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSSKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS",
        "proteome": "UP000028761",
        "gene": "YAP1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "24ea7820cd6f29e342ff8f359c11b836fc5a9e24",
        "counters": {
            "domain_architectures": 1573,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1573
        }
    }
}