GET /api/protein/UniProt/A0A2I3NE63/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I3NE63",
"id": "A0A2I3NE63_PAPAN",
"source_organism": {
"taxId": "9555",
"scientificName": "Papio anubis",
"fullName": "Papio anubis (Olive baboon)"
},
"name": "Cilia- and flagella-associated protein 300",
"description": [
"Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. May play a role in outer and inner dynein arm assembly"
],
"length": 267,
"sequence": "MATGELGDVGGYYFRFLPQKTFQSLNSKEITSRLRQWSMLGRIKAQAFGFDQTFQAYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWITLGTEVKKIEATNVPCTQVSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETAKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSSKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS",
"proteome": "UP000028761",
"gene": "YAP1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "24ea7820cd6f29e342ff8f359c11b836fc5a9e24",
"counters": {
"domain_architectures": 1573,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1573
}
}
}