GET /api/protein/UniProt/A0A2I3LMD1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I3LMD1",
        "id": "A0A2I3LMD1_PAPAN",
        "source_organism": {
            "taxId": "9555",
            "scientificName": "Papio anubis",
            "fullName": "Papio anubis (Olive baboon)"
        },
        "name": "Growth hormone-releasing hormone receptor",
        "description": [
            "Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion"
        ],
        "length": 393,
        "sequence": "MEGATAGLTMDRRMWGAHVLCVLSPLPTVLGHMYPECDFITQLREDESACLQAAEEMPNATLGCPRTWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEKESYFSTVKIIYTMGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDYCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLTCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVGCKLAFEDIACWDLDNSSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVL",
        "proteome": "UP000028761",
        "gene": "GHRHR",
        "go_terms": [
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004888",
                "name": "transmembrane signaling receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007166",
                "name": "cell surface receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "698a44734e6852726f7714e7370e1a4e9c280ea3",
        "counters": {
            "domain_architectures": 20578,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "prints": 2,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20578
        }
    }
}