General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I3CFL5",
        "id": "A0A2I3CFL5_VIBAX",
        "source_organism": {
            "taxId": "1219076",
            "scientificName": "Vibrio alginolyticus (strain ATCC 17749 / DSM 2171 / NBRC 15630 / NCIMB 1903 / NCTC 12160 / XII-53)",
            "fullName": "Vibrio alginolyticus (strain ATCC 17749 / DSM 2171 / NBRC 15630 / NCIMB 1903 / NCTC 12160 / XII-53)"
        },
        "name": "Ribosomal silencing factor RsfS",
        "description": [
            "Functions as a ribosomal silencing factor. Interacts with ribosomal protein uL14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation"
        ],
        "length": 105,
        "sequence": "MLREELKDFLADKADDMKAEDIIVLNVEDKSSVTDYMIICTGTSKRHVSSIADHVATEVKKAGLEPLGMEGENEGEWVVLDMGDAMLHVMQEEHRELYQLEKLWG",
        "proteome": null,
        "gene": "rsfS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d48e6f35bd449e7c5e049b7acf80a935592d4454",
        "counters": {
            "domain_architectures": 26485,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26485
        }
    }
}