GET /api/protein/UniProt/A0A2I2ZRZ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I2ZRZ7",
        "id": "A0A2I2ZRZ7_GORGO",
        "source_organism": {
            "taxId": "9595",
            "scientificName": "Gorilla gorilla gorilla",
            "fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
        },
        "name": "Fibronectin type 3 and ankyrin repeat domains protein 1",
        "description": [
            "Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis"
        ],
        "length": 344,
        "sequence": "MSPKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGHVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDQGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC",
        "proteome": "UP000001519",
        "gene": "FANK1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "19028327281c6137a19c9e0fe43f5e35bbb621f2",
        "counters": {
            "domain_architectures": 42283,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "profile": 3,
                "smart": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 42283
        }
    }
}