GET /api/protein/UniProt/A0A2I2ZMS5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I2ZMS5",
"id": "A0A2I2ZMS5_GORGO",
"source_organism": {
"taxId": "9595",
"scientificName": "Gorilla gorilla gorilla",
"fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
},
"name": "NAD kinase 2, mitochondrial",
"description": [
"Mitochondrial NAD(+) kinase that phosphorylates NAD(+) to yield NADP(+). Can use both ATP or inorganic polyphosphate as the phosphoryl donor"
],
"length": 410,
"sequence": "MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSRVVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYTGLLERHHIHTKNVEHIIDSLRNEGIEVRLVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFYRGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRSFNINRVATQAVEDVLNIAKRQGNLSLPLNRELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLEQ",
"proteome": "UP000001519",
"gene": "NADK2",
"go_terms": [
{
"identifier": "GO:0006741",
"name": "NADP+ biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8efde537f8cb548335688480591ccd83dfb10422",
"counters": {
"domain_architectures": 3705,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3705
}
}
}