General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I1CBS5",
        "id": "A0A2I1CBS5_ASPN1",
        "source_organism": {
            "taxId": "1392255",
            "scientificName": "Aspergillus novofumigatus (strain IBT 16806)",
            "fullName": "Aspergillus novofumigatus (strain IBT 16806)"
        },
        "name": "Ubiquinone biosynthesis protein",
        "description": [
            "Membrane-associated protein that warps the membrane surface to access and bind aromatic isoprenes with high specificity, including ubiquinone (CoQ) isoprene intermediates and presents them directly to Coq7, therefore facilitating the Coq7-mediated hydroxylase step. Participates in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration"
        ],
        "length": 297,
        "sequence": "MAQPVSLSRCSRRQINTLISSSITLSSRTNHSSHIALQARRLYQTQRSPRRLIHQPTQFSRPQQCIAKRSYHSQYHPELPPHEYTNSQTTILSAALNHVPKHGFTPEALTLGARDAGFLDVSVQLLPRGEFDLILFWLASRRGLLRGKVENGFFEKIESQGKALSVEEKTKLLIMERLRMNAEIKHQWQGALALMSLAGNIPLSLSELHALSSDILDLAGDASVDASWYTKRLSISAIYASAEVVMTRDPSPDLSATQAFVDRRIEDNKYIGDKITGIKQCLGFMGSTAVGLGRSWG",
        "proteome": "UP000234474",
        "gene": "P174DRAFT_439760",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b0db59e28334cd4722a223e129b60439ebd95e1b",
        "counters": {
            "domain_architectures": 1692,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1692
        }
    }
}