General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I1C9V7",
        "id": "A0A2I1C9V7_ASPN1",
        "source_organism": {
            "taxId": "1392255",
            "scientificName": "Aspergillus novofumigatus (strain IBT 16806)",
            "fullName": "Aspergillus novofumigatus (strain IBT 16806)"
        },
        "name": "Probable NAD(P)H-dependent D-xylose reductase xyl1",
        "description": [
            "Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway"
        ],
        "length": 310,
        "sequence": "MTKFKLNTGAEIPAIGFGTWQDEHAQEDAVTEALKAGYRHIDTARVYLTEKAVGRAIKKSGVPREELFVTTKLWNNKHHPDDVEGALDASLADLELDYVDLYLMHWPVAWKRGDELFPKENGKYVLEDIDIVDTYKAMEKLLSTGKTKAIGVSNFSKAEMERLIQNTSVVPAVHQLEGHPWLQQRSFVDWHKSKGIHVTHYSPFGNQNEIYSSKVQIGKLIDEPVLVEIGKKYNKSSAQVALAWGVTQGHSVLPKSKTPSRIKANLEGDFHLSDEDMKKIQGIDKKLRFNDSSADFGRDFFTDLEGKGSV",
        "proteome": "UP000234474",
        "gene": "P174DRAFT_512550",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e96b765c85e65c75beacfc1efe2818f689e0515d",
        "counters": {
            "domain_architectures": 291149,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 291149
        }
    }
}