GET /api/protein/UniProt/A0A2I1C9V7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I1C9V7",
"id": "A0A2I1C9V7_ASPN1",
"source_organism": {
"taxId": "1392255",
"scientificName": "Aspergillus novofumigatus (strain IBT 16806)",
"fullName": "Aspergillus novofumigatus (strain IBT 16806)"
},
"name": "Probable NAD(P)H-dependent D-xylose reductase xyl1",
"description": [
"Catalyzes the initial reaction in the xylose utilization pathway by reducing D-xylose into xylitol. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway"
],
"length": 310,
"sequence": "MTKFKLNTGAEIPAIGFGTWQDEHAQEDAVTEALKAGYRHIDTARVYLTEKAVGRAIKKSGVPREELFVTTKLWNNKHHPDDVEGALDASLADLELDYVDLYLMHWPVAWKRGDELFPKENGKYVLEDIDIVDTYKAMEKLLSTGKTKAIGVSNFSKAEMERLIQNTSVVPAVHQLEGHPWLQQRSFVDWHKSKGIHVTHYSPFGNQNEIYSSKVQIGKLIDEPVLVEIGKKYNKSSAQVALAWGVTQGHSVLPKSKTPSRIKANLEGDFHLSDEDMKKIQGIDKKLRFNDSSADFGRDFFTDLEGKGSV",
"proteome": "UP000234474",
"gene": "P174DRAFT_512550",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e96b765c85e65c75beacfc1efe2818f689e0515d",
"counters": {
"domain_architectures": 291149,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 2,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 291149
}
}
}