General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I1BUZ0",
        "id": "A0A2I1BUZ0_ASPN1",
        "source_organism": {
            "taxId": "1392255",
            "scientificName": "Aspergillus novofumigatus (strain IBT 16806)",
            "fullName": "Aspergillus novofumigatus (strain IBT 16806)"
        },
        "name": "Endo-1,4-beta-xylanase",
        "description": [
            "Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose"
        ],
        "length": 304,
        "sequence": "MANVFCFGLAAIAGAYAPPGDKSVNLAERQTITSSQTGTNNGYYYSFWTNGAGVTWANQNGGDFTCGKGWNPGSDHDISFSGSFNPSGNAYLSVYGWTTSPLVEYYILENYGSYNPGSSMTHKGTVTSDGSTYDIYEHQQVNQPSIVGTATFNQYWSIRQNKRSSGTVTTANHFKAWASLGMNLGTHNYQIVSTEGYESSGTSTITVSSGGSSSGGSGGSSSTTSSGSSPTGGSGSVSLLPHDCGFMRILTVIVLCFVGPVRWNRLVWPYLLLFGHLQGLQLVLLPVLVALSCRVISKTGRKSK",
        "proteome": "UP000234474",
        "gene": "P174DRAFT_464341",
        "go_terms": [
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2a45ebb1090c68cd7585a5d663a5eaf2f9354f16",
        "counters": {
            "domain_architectures": 4946,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4946
        }
    }
}