GET /api/protein/UniProt/A0A2H3HUH5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2H3HUH5",
        "id": "A0A2H3HUH5_FUSOX",
        "source_organism": {
            "taxId": "327505",
            "scientificName": "Fusarium oxysporum f. sp. radicis-cucumerinum",
            "fullName": "Fusarium oxysporum f. sp. radicis-cucumerinum"
        },
        "name": "Serine/threonine-protein phosphatase 2A activator",
        "description": [
            "PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for PP2A-like phosphatases modulating their activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2Ai) in presence of ATP and Mg(2+) by dissociating the inactive form from the complex"
        ],
        "length": 427,
        "sequence": "MDSQASTQSAPLQGEASSIPNLKDRLPKLEPRKRRSATSNPTPIPETPALPTPPDTSDWTFKTPSRRILSKKDHDIFLSSPTYELITAWVFGLAESVVDTPNSAVRDADLSSPLKVILHILDETEQLVAKSPPNEQGGSRFGNKAFRGLLELAQSNSAAWHREIGVQDEGAIAELSTYFCQSFGNGNRIDYGSGHELNFMIWLLCLYQLGLLKQSDFKPLVLRVFVRYLEVMRVIQMTYYLEPAGSHGVWGLDDYQFLPFLFGATQLLHHPYITPRAIHQDLTLEEFGHDYMYLGQVSFVNSTKTVKGLRWHSPMLDDISSARSWTKIDGGMRRMFVAEVLGKLPVMQHFLFGSLVPAADGMSEDTGTGEDENAEHDPHEGHDHTGKAHDGTGWGDCCGIKVPSSIAAAQEMKKRGGDQGLRRIPFD",
        "proteome": null,
        "gene": "AU210_000850",
        "go_terms": [
            {
                "identifier": "GO:0019211",
                "name": "phosphatase activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "72ff6fad7eb2a23f6de70223ef85ba73d19c8cc3",
        "counters": {
            "domain_architectures": 7072,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7072
        }
    }
}