HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2D0SY13",
"id": "A0A2D0SY13_ICTPU",
"source_organism": {
"taxId": "7998",
"scientificName": "Ictalurus punctatus",
"fullName": "Ictalurus punctatus (Channel catfish)"
},
"name": "G-protein coupled receptors family 1 profile domain-containing protein",
"description": null,
"length": 403,
"sequence": "MDIADASFPVFNSSANGTSAPILTPHSRCAAAFIILVVTVIILVTIVGNVLVVVAVFTSRALRAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGSTWCALYLALDVLFCTSSIVHLCAISLDRYWSVTSAVSYNLKRTPRRVKTMIAAVWLISAVISFPPLVMTKHDELECLLNNDTWYILASCAVSFFAPGLIMVSVYCKIYRVAKQRAATVFVAKAIMARQPSLSETGFVRKGRSEATSPSVCGSKEQNQGELDAIDLEESCVSSARSAKSGKVEVACVCARAKLDGRASEVCEHEPVNRVRQSSMSKAKLAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSLHAVCRESCTIPDTLFDLFFWIGYCNSSVNPIIYTIFNRDFRRAFKKIICHTK",
"proteome": "UP000221080",
"gene": "adra2db",
"go_terms": [
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004938",
"name": "alpha2-adrenergic receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006940",
"name": "regulation of smooth muscle contraction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019229",
"name": "regulation of vasoconstriction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030168",
"name": "platelet activation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004935",
"name": "adrenergic receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
"counters": {
"domain_architectures": 394800,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 3,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 394800
}
}
}