GET /api/protein/UniProt/A0A2D0PJ81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2D0PJ81",
"id": "A0A2D0PJ81_ICTPU",
"source_organism": {
"taxId": "7998",
"scientificName": "Ictalurus punctatus",
"fullName": "Ictalurus punctatus (Channel catfish)"
},
"name": "Prostamide/prostaglandin F synthase",
"description": [
"Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha)"
],
"length": 200,
"sequence": "MSIQLDKLSSNTVKSSVSGEHVELGSLWKDKTVVMFFLRRFGCQICRWAAAEVSKLEKDLRENGVALIGIGPEETGLQEFKDGGFFKGEIYIDEKKQCYKELGFKRYNAINVLPAALGKKVREIASKASNEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQETPGDLVSLEDITKVLGISASVQAGVKPQCNDDVCTR",
"proteome": "UP000221080",
"gene": "prxl2b",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "443fb9c0d4ac90645217a3004302a8d616e2ab64",
"counters": {
"domain_architectures": 9787,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9787
}
}
}