HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A291ACW2",
"id": "A0A291ACW2_9PSED",
"source_organism": {
"taxId": "104087",
"scientificName": "Pseudomonas frederiksbergensis",
"fullName": "Pseudomonas frederiksbergensis"
},
"name": "Ribosomal protein uS12 methylthiotransferase RimO",
"description": [
"Catalyzes the methylthiolation of an aspartic acid residue of ribosomal protein uS12"
],
"length": 445,
"sequence": "MSTTPAPANPKVGFVSLGCPKALVDSERILTQLRMEGYDVVSTYQDADVVVVNTCGFIDSAKAESLEVIGEAIKENGKVIVTGCMGVEEGNIRNVHPSVLAVTGPQQYEQVVNAVHDVVPPRQDHNPLIDLVPPQGIKLTPRHYAYLKISEGCNHSCSFCIIPSMRGKLVSRPVGDVLDEAQRLVKSGVKELLVISQDTSAYGVDVKYRTGFWNGAPVKTRMTELCEALSTLGVWVRLHYVYPYPHVDELIPLMAAGKILPYLDIPFQHASPKVLKAMKRPAFEDKTLARIKNWREICPDLIIRSTFIVGFPGETEEDFQYLLNWLTEAQLDRVGCFQYSPVEGAPANDLDLEIVPDDVKQDRWDRFMAHQQAISSARLQMRIGREIEVLVDEVDEQGAVGRCFFDAPEIDGNVFIDNGSNLKPGDKVWCKVTDADEYDLWAEQI",
"proteome": null,
"gene": "rimO",
"go_terms": [
{
"identifier": "GO:0035596",
"name": "methylthiotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006400",
"name": "tRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0018339",
"name": "peptidyl-L-beta-methylthioaspartic acid biosynthetic process from peptidyl-aspartic acid",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "720538ec35dc3fd38412b2d06407e7c5f9ea5637",
"counters": {
"domain_architectures": 15934,
"entries": 32,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"cathgene3d": 3,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 3,
"sfld": 4,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 11
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15934
}
}
}