HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A290XHJ4",
"id": "A0A290XHJ4_9GAMM",
"source_organism": {
"taxId": "2006110",
"scientificName": "Luteimonas chenhongjianii",
"fullName": "Luteimonas chenhongjianii"
},
"name": "Molybdenum transport system permease",
"description": [
"Part of the binding-protein-dependent transport system for molybdenum; probably responsible for the translocation of the substrate across the membrane"
],
"length": 235,
"sequence": "MDLPAALHFAPEELEAIRLSLKVATAAALCSLPFGIATAWLLARRRFFGSSLLDALVHLPLVLPPVVVGYALLVMLGGNGVIGHWLEDTLGVSVAFRWTGAALASAIMGFPLMVRAIRLSIENVDRRLEQAAATLGASPWRVFRTITLPLAWPGVVAGAVLAFAKALGEFGATITFVSNIPGETQTISSAIYSLMQVPGGEAGIWRLAAVSVAISLAALLASEWLVRRQRGEAHD",
"proteome": "UP000218968",
"gene": "CNR27_14065",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015098",
"name": "molybdate ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015689",
"name": "molybdate ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "149ba0064877cb2f3007f9b95b1a3d82ad06c810",
"counters": {
"domain_architectures": 894065,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"panther": 1,
"ncbifam": 2,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 894065
}
}
}