General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A287BLI6",
        "id": "A0A287BLI6_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "RING finger protein 37",
        "description": [
            "May have a ubiquitin-protein ligase activity acting as an E3 ubiquitin-protein ligase or as a ubiquitin-ubiquitin ligase promoting elongation of ubiquitin chains on substrates"
        ],
        "length": 541,
        "sequence": "MVINLCLPQFKPRIYCNKISADGYEVENLISEDLIKRSHGFRTEYFIKPPVYVTVSFPFSVEICRINIDLPTAGGQNVTGLEMYTSALSSRASWSTPDCRTPGPAEPPIPGKEAFTLVGKVLLKNQSQVVFSHRGFKARPPFSPMEATLPSPAVVAQELWNKGALSLSHVAHVKICITHVTGSGIPCIKRLEVWGQPAKTCSQEVIDSVLLVASESLPQDLSLQAPALPMESDCDAGGQSEGQQAPSSLQELAEVLQDVPEEFLDPITLEIMPYPMLLPSGKVIDQSTLEKCNRSEAAWGRVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCNLLGRAQTASAVTPSSIALPSRKRKMEEAEHAPDGSLGSNASCFSTTSLLVSPTTSEHTAKKMKAASELGMTHMDCSTGPLSHEQKLSQSLEIALMSTLGSIPSFTARPPRGQLQHLGTRGGSTSLRPGASSEQPGGSLGPECASCKRVFSPYVKKEPMYQLPCGHLLCRPCLAEKQRSLPMTCTACQQPVASQDILRVHF",
        "proteome": "UP000008227",
        "gene": "UBOX5",
        "go_terms": [
            {
                "identifier": "GO:0004842",
                "name": "ubiquitin-protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016567",
                "name": "protein ubiquitination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a2531b0905e80a590c8f6976c97bb06b2be420f3",
        "counters": {
            "domain_architectures": 924,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 2,
                "pfam": 2,
                "cdd": 2,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 924
        }
    }
}