GET /api/protein/UniProt/A0A286XEI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A286XEI1",
"id": "A0A286XEI1_CAVPO",
"source_organism": {
"taxId": "10141",
"scientificName": "Cavia porcellus",
"fullName": "Cavia porcellus (Guinea pig)"
},
"name": "Pleckstrin homology domain-containing family F member 1",
"description": [
"May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8"
],
"length": 278,
"sequence": "MVDHLVNTEINSQRIAAVENCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLSKRKYRSQHIIPLEEVTLEPLPDTLEAKNRWMIKTAKKSFVVSAASPTERQEWLSHIEECVRRQLLATGHQPTTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCYRELAAQKLKEEAEEQGRVSPEQLAHLGGALYGASSGDDDSDEDKEGSRDGDWPSRVQFYASSVSWSAFHS",
"proteome": "UP000005447",
"gene": "PLEKHF1",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "934138eaaecada7d8609be99db9164767204da69",
"counters": {
"domain_architectures": 2160,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"ssf": 2,
"cathgene3d": 2,
"profile": 2,
"smart": 2,
"pfam": 2,
"panther": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2160
}
}
}