GET /api/protein/UniProt/A0A265BCF4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A265BCF4",
        "id": "A0A265BCF4_SALET",
        "source_organism": {
            "taxId": "611",
            "scientificName": "Salmonella enterica subsp. enterica serovar Heidelberg",
            "fullName": "Salmonella enterica subsp. enterica serovar Heidelberg"
        },
        "name": "Tol-Pal system protein TolB",
        "description": [
            "Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. TolB occupies a key intermediary position in the Tol-Pal system because it communicates directly with both membrane-embedded components, Pal in the outer membrane and TolA in the inner membrane"
        ],
        "length": 430,
        "sequence": "MKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKWAGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQIRQITDGRSNNTEPTWFPDSQTLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQNQDADVSSDGKFMVMVSSNNGQQHIAKQDLVTGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKSPAWSPYL",
        "proteome": null,
        "gene": "tolB",
        "go_terms": [
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042597",
                "name": "periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0017038",
                "name": "protein import",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "767f3dec1b5cb7ef345c5a836ed64d5467974377",
        "counters": {
            "domain_architectures": 5084,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5084
        }
    }
}