GET /api/protein/UniProt/A0A250B112/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A250B112",
        "id": "A0A250B112_9GAMM",
        "source_organism": {
            "taxId": "929813",
            "scientificName": "Gibbsiella quercinecans",
            "fullName": "Gibbsiella quercinecans"
        },
        "name": "Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase",
        "description": [
            "Catalyzes the transfer of the GlcNAc-1-phosphate moiety from UDP-GlcNAc onto the carrier lipid undecaprenyl phosphate (C55-P), yielding GlcNAc-pyrophosphoryl-undecaprenyl (GlcNAc-PP-C55)"
        ],
        "length": 359,
        "sequence": "MSTELLFVFLFSLAFLFVARKVAKRIGLVDRPNYRKRHQGMIPLVGGISVYIGLCFAFLISDQTIAHGKLYLACAGVLVLVGALDDRYDISVKIRALVQALVGIAMMVFAGLYLRSFGHVLGNWEMQLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSCVSFGALGLLLYLSGHTDRAFWCFAMIAAIVPYVLLNLGILGRRYKVFMGDAGSTLIGFTAIWLLLQSSQGVSHAINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIHHLIMRAGFTPNQAFVLITLAAALLAAIGVLGERLTFIPEWFMLALFLLAFLFYGYCIKRAWRVARYIKRLKRRMRRSGNKQQP",
        "proteome": "UP000217182",
        "gene": "wecA",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030145",
                "name": "manganese ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036380",
                "name": "UDP-N-acetylglucosamine-undecaprenyl-phosphate N-acetylglucosaminephosphotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009103",
                "name": "lipopolysaccharide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009276",
                "name": "Gram-negative-bacterium-type cell wall",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016780",
                "name": "phosphotransferase activity, for other substituted phosphate groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c5f156dcacc2831f4f03c4654ba034cef8945ec7",
        "counters": {
            "domain_architectures": 33525,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33525
        }
    }
}