General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A239ES33",
        "id": "A0A239ES33_EKHLU",
        "source_organism": {
            "taxId": "447679",
            "scientificName": "Ekhidna lutea",
            "fullName": "Ekhidna lutea"
        },
        "name": "Phosphoribosylglycinamide formyltransferase",
        "description": [
            "Catalyzes the transfer of a formyl group from 10-formyltetrahydrofolate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR) and tetrahydrofolate"
        ],
        "length": 188,
        "sequence": "MNKPINLAIFASGSGTNAENISKHFEDHDSIQVKEILSNRKSAGVHARAEKLEIPSATFSREQFNDPSFIKQLSDFDYIILAGFLWLIPRYLIKAFPNKIINIHPALLPKFGGKGMYGTNVHKAVIESGDKESGITIHLVNEEYDKGKILFQSKCEVAKNDTPESLAQKIHALEYEHFPKVIERVVLG",
        "proteome": "UP000198393",
        "gene": "purN",
        "go_terms": [
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004644",
                "name": "phosphoribosylglycinamide formyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006189",
                "name": "'de novo' IMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f021b3146ef7ec171dc79da7ee22bff4e1740d0f",
        "counters": {
            "domain_architectures": 41387,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 41387
        }
    }
}