GET /api/protein/UniProt/A0A231FXB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A231FXB9",
        "id": "A0A231FXB9_PSEJE",
        "source_organism": {
            "taxId": "77298",
            "scientificName": "Pseudomonas jessenii",
            "fullName": "Pseudomonas jessenii"
        },
        "name": "Protein translocase subunit SecY",
        "description": [
            "The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently"
        ],
        "length": 442,
        "sequence": "MAKQGALSALGKGGMSELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSVGLAGQGVAFTGDFGFHFVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGSGMLR",
        "proteome": "UP000198542",
        "gene": "secY",
        "go_terms": [
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9938721f5ebf4880c46db3c12966b5aff0b4c61",
        "counters": {
            "domain_architectures": 31007,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31007
        }
    }
}