HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A223MZJ2",
"id": "A0A223MZJ2_9VIBR",
"source_organism": {
"taxId": "2025808",
"scientificName": "Vibrio qinghaiensis",
"fullName": "Vibrio qinghaiensis"
},
"name": "5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase",
"description": [
"Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) to adenine and the corresponding thioribose, 5'-methylthioribose and S-ribosylhomocysteine, respectively. Also cleaves 5'-deoxyadenosine, a toxic by-product of radical S-adenosylmethionine (SAM) enzymes, into 5-deoxyribose and adenine"
],
"length": 231,
"sequence": "MKIGIIGAMEQEVAILKNAIDNVQQVSKAGCTYFSGQIHGVDVVLLQSGIGKVAAAIGTTLLLDEYQPDVVINTGSAGGFDSSLTMGDVVISSEVRHHDADVTAFGYEMGQMAGQPAAFKADEALIRVAEQALTHIKDKHAVRGLICTGDAFVCSAERQSFIRQHFPTVIAVEMEASAIAQTCHQFKVPFVVVRAISDVADKASPMSFDEFLPLAAQSSSEMVIKMVELLK",
"proteome": "UP000215148",
"gene": "mtnN",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009116",
"name": "nucleoside metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008782",
"name": "adenosylhomocysteine nucleosidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008930",
"name": "methylthioadenosine nucleosidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009164",
"name": "nucleoside catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019509",
"name": "L-methionine salvage from methylthioadenosine",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
"counters": {
"domain_architectures": 85785,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85785
}
}
}