HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A223MD57",
"id": "A0A223MD57_ACTPL",
"source_organism": {
"taxId": "715",
"scientificName": "Actinobacillus pleuropneumoniae",
"fullName": "Actinobacillus pleuropneumoniae"
},
"name": "Large-conductance mechanosensitive channel",
"description": [
"Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell"
],
"length": 129,
"sequence": "MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLIGGVDFKDLAIEIAPAKEGAEAVMLKYGAFIQNVFDFLIIAIAVFGMVKVINKIKKPAEAAPAEPTAEEKLLTEIRDLLKK",
"proteome": null,
"gene": "mscL",
"go_terms": [
{
"identifier": "GO:0008381",
"name": "mechanosensitive monoatomic ion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034220",
"name": "monoatomic ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6f99e8018eaa5607dc65dc2829aed0b45775c497",
"counters": {
"domain_architectures": 21782,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 21782
}
}
}