General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A223FPP9",
        "id": "A0A223FPP9_RAPSA",
        "source_organism": {
            "taxId": "3726",
            "scientificName": "Raphanus sativus",
            "fullName": "Raphanus sativus (Radish)"
        },
        "name": "Naringenin,2-oxoglutarate 3-dioxygenase",
        "description": [
            "Catalyzes the 3-beta-hydroxylation of 2S-flavanones to 2R,3R-dihydroflavonols which are intermediates in the biosynthesis of flavonols, anthocyanidins, catechins and proanthocyanidins in plants"
        ],
        "length": 358,
        "sequence": "MAPGTLTELAGETKLNSKFVRDEDERPKVAYNEFSTEIPVISLAGIDDVGGKRGEICRQIVEACENWGVFQVVDHGVDTSLVADMTRLARDFFALAPEEKLKFDMSGGKKGGFIVSSHLQGESVQDWREIVTYFSYPVRNRDYSRWPTKPEGWVKVTEEYSEKLMSLACKLLEVLSEAMGLEKEALTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQVGGLQATRDDGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRLSIATFQNPAPEATVYPLKVREGEKPILEEPITFAEMYKRKMSRDIELARLKKLAKEEHDHKEAGKPLDQIIA",
        "proteome": "UP000504610",
        "gene": "F3H-RL-1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dba0199fa67b925969a474f1e6e1a81dee82ff76",
        "counters": {
            "domain_architectures": 86072,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 86072
        }
    }
}