GET /api/protein/UniProt/A0A221NVB2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A221NVB2",
        "id": "A0A221NVB2_9ACTN",
        "source_organism": {
            "taxId": "1355015",
            "scientificName": "Streptomyces pluripotens",
            "fullName": "Streptomyces pluripotens"
        },
        "name": "L-2,4-diaminobutyric acid acetyltransferase",
        "description": [
            "Catalyzes the acetylation of L-2,4-diaminobutyrate (DABA) to gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) with acetyl coenzyme A"
        ],
        "length": 172,
        "sequence": "MTAAPADLLIDRPAVSDGAALWRLAKDSKTLDLNSSYSYLLWCRDFAGTSVVARGADGEAVGFVTGYLRPDRPGTLLIWQVAVDAAHRGHGIAAALLDALTERLADEHGITDVETTITPGNTASERLFTSFAARHHARLTREVLFPTDLFPDGPHDPEVLYRIGPLNPSTSH",
        "proteome": "UP000031501",
        "gene": "ectA",
        "go_terms": [
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033816",
                "name": "diaminobutyrate acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019491",
                "name": "ectoine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b275a6f4148e51878711e7aee687990d48d71c3c",
        "counters": {
            "domain_architectures": 467067,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 467067
        }
    }
}