General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A220U058",
        "id": "A0A220U058_9BACI",
        "source_organism": {
            "taxId": "2017483",
            "scientificName": "Virgibacillus phasianinus",
            "fullName": "Virgibacillus phasianinus"
        },
        "name": "DNA-3-methyladenine glycosylase I",
        "description": [
            "Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine from the damaged DNA polymer formed by alkylation lesions"
        ],
        "length": 188,
        "sequence": "MVKRCDWTTSDQLYIDYHDHEWGKPTHDDQELFEMLCLEGAQAGLSWITILKRRDNYRKAFDNFDPGIIQTYNEDKIQEILQDEGIIRNKLKVRSVVTNAAAFLKIQEEFGSFDAYIWSFVGGQPILNDWKEHADVPASTDESKQMSKDLKKRGFKFVGPTICYAYMQSTGMVNDHIQDCFLYHGKRG",
        "proteome": "UP000198312",
        "gene": "CFK37_04250",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008725",
                "name": "DNA-3-methyladenine glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "81a03f1851aee307a1a0f8c22cb79c4d96000f07",
        "counters": {
            "domain_architectures": 25894,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25894
        }
    }
}