GET /api/protein/UniProt/A0A212IPY4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A212IPY4",
        "id": "A0A212IPY4_9ENTR",
        "source_organism": {
            "taxId": "200446",
            "scientificName": "uncultured Citrobacter sp.",
            "fullName": "uncultured Citrobacter sp."
        },
        "name": "Protein-export protein SecB",
        "description": [
            "One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA"
        ],
        "length": 155,
        "sequence": "MSEQNNTEMAFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSISGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA",
        "proteome": null,
        "gene": "secB",
        "go_terms": [
            {
                "identifier": "GO:0051082",
                "name": "unfolded protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051262",
                "name": "protein tetramerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f0a036645021158493403eb20eadf6fd71476d92",
        "counters": {
            "domain_architectures": 9660,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 3,
                "pfam": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9660
        }
    }
}