HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A212IPY4",
"id": "A0A212IPY4_9ENTR",
"source_organism": {
"taxId": "200446",
"scientificName": "uncultured Citrobacter sp.",
"fullName": "uncultured Citrobacter sp."
},
"name": "Protein-export protein SecB",
"description": [
"One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA"
],
"length": 155,
"sequence": "MSEQNNTEMAFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLDTASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSISGIEGTQMAHCLGAYCPNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA",
"proteome": null,
"gene": "secB",
"go_terms": [
{
"identifier": "GO:0051082",
"name": "unfolded protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015031",
"name": "protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0051262",
"name": "protein tetramerization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f0a036645021158493403eb20eadf6fd71476d92",
"counters": {
"domain_architectures": 9660,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 3,
"pfam": 1,
"prints": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9660
}
}
}